Sales outreach
All 754 of these sites already run Vidoomy, with the newspaper publishing segment leading at 15 sites. Pitch the products and services that fit that exact stack.
Advertising & Media Advertising Software Visit website
Vidoomy is a company specialized in digital video advertising. It connects advertisers with premium publishers to deliver high-impact video campaigns while maximizing revenue for publishers.
Up to 1M sites per list · Segment by country & TLD to cover the full footprint · Unlimited report rebuilds for 1 month
And 39 more countries in the full dataset.
Need every Vidoomy site in one market? Unlock Vidoomy once and rebuild filtered reports as often as you like for a month: by country, TLD, or stack combination, each with up to 20 data points per site.
Start from $39/moCountry groups overlap: a country can belong to several at once (Germany counts toward Europe, Western Europe, the EU and DACH). Percentages are each group's share of the 749 sites with a known country, so they describe overlapping views of the same data and do not add up to 100%.
| # | Website | Popularity | StackSpend | Country | TLD |
|---|---|---|---|---|---|
| 01 |
|
1,636 | $3.92K+ | 🇧🇷 Brazil | com |
| 02 |
|
9,760 | $37.99K+ | 🇧🇩 Bangladesh | com |
| 03 |
|
22,497 | $39.77K+ | 🇦🇷 Argentina | com |
| 04 | conjur.com.br | 42,882 | $16.76K+ | 🇧🇷 Brazil | br |
| 05 | voltairenet.org | 46,077 | $1.33K+ | 🇫🇷 France | org |
| 06 | orientacionandujar.es | 59,836 | $3.2K+ | 🇪🇸 Spain | es |
| 07 |
|
60,029 | $3.01K+ | 🇹🇹 Trinidad and Tobago | tt |
| 08 |
|
61,371 | $1.33K+ | 🇧🇩 Bangladesh | com |
| 09 |
|
63,636 | $20.24K+ | 🇦🇷 Argentina | ar |
| 10 |
|
65,927 | $1.97K+ | 🇧🇷 Brazil | br |
| 11 | descopera.ro | 67,234 | $252K+ | 🇷🇴 Romania | ro |
| 12 |
|
67,316 | $1.33K+ | 🇧🇩 Bangladesh | com |
| 13 | fotospor.com | 70,110 | $23.11K+ | 🇹🇷 Turkey | com |
| 14 |
|
72,463 | $16.22K+ | 🇦🇷 Argentina | com |
| 15 | csid.ro | 77,991 | $234K+ | 🇷🇴 Romania | ro |
| 16 | diarioversionfinal.com | 79,653 | $2.27K+ | 🇺🇸 United States | com |
| 17 | actividadesdeinfantilyprimaria.com | 82,069 | $2.35K+ | 🇫🇷 France | com |
| 18 | nextgen-auto.com | 84,662 | $2.33K+ | 🇫🇷 France | com |
| 19 | limakid.com | 90,564 | $1.33K+ | 🇺🇸 United States | com |
| 20 |
|
90,775 | $2.98K+ | 🇧🇴 Bolivia | com |
This is 20 of 754 websites. Download up to 1M sites per list as CSV, enriched with firmographics.
| Company | Website | Employees | Industry | Country | Founded |
|---|---|---|---|---|---|
| Agencia Carabobeña De Noticias (ACN) |
|
11-50 | Online Audio and Video Media | 🇻🇪 Venezuela | - |
| La Vinotinto |
|
- | - | 🇺🇳 - | - |
| Ajker Patrika |
|
501-1000 | Newspaper Publishing | 🇧🇩 Bangladesh | 2021 |
| Daily Jugantor |
|
1001-5000 | Newspaper Publishing | 🇧🇩 Bangladesh | 1999 |
| Jornal De Brasília |
|
51-200 | Newspaper Publishing | 🇧🇷 Brazil | 1972 |
| Formate.pe |
|
1-10 | Education | 🇺🇳 - | - |
| Grupo NOTICIAS Voz E Imagen (NVI) |
|
201-500 | Technology, Information and Media | 🇲🇽 Mexico | 1976 |
| TC Televisión |
|
201-500 | Broadcast Media Production and Distribution | 🇪🇨 Ecuador | 1969 |
| CONTACTO HOY EL PERIODICO DEL MILENIO |
|
11-50 | Book and Periodical Publishing | 🇺🇳 - | - |
| Daily Inqilab |
|
1001-5000 | newspapers | 🇧🇩 Bangladesh | 1986 |
| PERIODISMO PÚBLICO |
|
1-10 | Online Media | 🇨🇴 Colombia | 2009 |
| Diario Huarpe |
|
51-200 | Telecommunications | 🇦🇷 Argentina | 2005 |
| Radio Carolina |
|
501-1000 | Music | 🇨🇱 Chile | - |
| Haszon Magazine |
|
11-50 | Media Production | 🇭🇺 Hungary | - |
| Guardian Media Limited |
|
501-1000 | Media Production | 🇹🇹 Trinidad and Tobago | - |
| The Daily Manab Zamin |
|
201-500 | Newspaper Publishing | 🇧🇩 Bangladesh | 1997 |
| The Herald |
|
1001-5000 | Book and Periodical Publishing | 🇿🇦 South Africa | - |
| QdM Notizie |
|
1-10 | Book and Periodical Publishing | 🇺🇳 - | - |
| Diario El Territorio |
|
51-200 | Broadcast Media Production and Distribution | 🇺🇳 - | - |
| Diario Popular |
|
51-200 | Newspaper Publishing | 🇦🇷 Argentina | 1974 |
| Prácticas Perú |
|
1-10 | Human Resources | 🇺🇳 - | - |
| EMBRIOGYN |
|
11-50 | Health, Wellness & Fitness | 🇪🇸 Spain | 2006 |
| Daily Rupali Bangladesh |
|
51-200 | newspapers | 🇧🇩 Bangladesh | 2023 |
| Geekno |
|
1-10 | - | 🇪🇸 Spain | - |
| Sports Racing News |
|
11-50 | Internet Publishing | 🇺🇸 United States | - |
| Sempione News |
|
1-10 | Online Audio and Video Media | 🇮🇹 Italy | 2016 |
| Grupo Verde Vale De Comunicação |
|
11-50 | Media Production | 🇧🇷 Brazil | 2012 |
| Editorial Aguasclaras S.A. |
|
51-200 | Newspaper Publishing | 🇨🇴 Colombia | - |
| Los Tiempos |
|
51-200 | Newspaper Publishing | 🇧🇴 Bolivia | 1943 |
| Radio Infinita |
|
11-50 | Broadcast Media Production and Distribution | 🇨🇱 Chile | 1977 |
| Anacleto Cardoso Cação Unip. Lda |
|
1-10 | Construction | 🇵🇹 Portugal | - |
| Mpasho News |
|
11-50 | Entertainment Providers | 🇺🇳 - | 2014 |
| HAMU és GYÉMÁNT Kft. |
|
1-10 | - | 🇭🇺 Hungary | - |
| Brillientgames |
|
1-10 | Computer Games | 🇺🇳 - | 2020 |
| Noticia Al Día |
|
11-50 | Information Services | 🇻🇪 Venezuela | 2009 |
| Atlas Da Saúde |
|
1-10 | Wellness and Fitness Services | 🇵🇹 Portugal | 2013 |
| InfoNegocios |
|
11-50 | Broadcast Media Production and Distribution | 🇦🇷 Argentina | 2003 |
| INJujuy |
|
1-10 | Broadcast Media Production and Distribution | 🇦🇷 Argentina | - |
| 970 Universal |
|
11-50 | Media and Telecommunications | 🇺🇳 - | - |
| Todocircuito.com |
|
1-10 | Technology, Information and Internet | 🇪🇸 Spain | 2006 |
A sample of enriched company profiles. Full exports include company, social, and spend signals on every domain.
Put it to work
All 754 of these sites already run Vidoomy, with the newspaper publishing segment leading at 15 sites. Pitch the products and services that fit that exact stack.
Selling Meta Business Suite, Google AdSense, or another Advertising Software product? These 754 Vidoomy users are your displacement audience, filterable by country and company size.
Top markets for Vidoomy: United States (25%), Poland (11.3%), Spain (9.5%). Size the Advertising Software market by geography before you build or invest.
Free for non-profits, academia & data journalists - non-commercial and public-interest use, on request.
Request accessUnlock Vidoomy and download unlimited filtered reports for a month: up to 1M sites per list, segmented by country and TLD.
No contracts, cancel anytime · Instant access after checkout · Data point availability varies by website and report