Sales outreach
All 564 of these sites already run Seedtag, with the online audio and video media segment leading at 16 sites. Pitch the products and services that fit that exact stack.
Advertising & Media Advertising Software Visit website
Seedtag is a proprietary AI platform that applies neuroscience principles to translate consumer thought into advertising action.
Up to 1M sites per list · Segment by country & TLD to cover the full footprint · Unlimited report rebuilds for 1 month
And 22 more countries in the full dataset.
Need every Seedtag site in one market? Unlock Seedtag once and rebuild filtered reports as often as you like for a month: by country, TLD, or stack combination, each with up to 20 data points per site.
Start from $39/moCountry groups overlap: a country can belong to several at once (Germany counts toward Europe, Western Europe, the EU and DACH). Percentages are each group's share of the 562 sites with a known country, so they describe overlapping views of the same data and do not add up to 100%.
| # | Website | Popularity | StackSpend | Country | TLD |
|---|---|---|---|---|---|
| 01 | quizur.com | 17,625 | $2.72K+ | 🇧🇷 Brazil | com |
| 02 |
|
18,625 | $3.95K+ | 🇲🇽 Mexico | mx |
| 03 |
|
37,368 | $1.27K+ | 🇨🇴 Colombia | co |
| 04 | influenceimmo.com | 48,943 | $1.33K+ | 🇫🇷 France | com |
| 05 |
|
53,887 | $5.1K+ | 🇪🇸 Spain | es |
| 06 |
|
55,438 | $27.35K+ | 🇳🇱 Netherlands | com |
| 07 | orientacionandujar.es | 59,836 | $3.2K+ | 🇪🇸 Spain | es |
| 08 |
|
60,486 | $83.11K+ | 🇨🇴 Colombia | com |
| 09 | ofuxico.com.br | 63,924 | $3.91K+ | 🇧🇷 Brazil | br |
| 10 |
|
65,797 | $1.99K+ | 🇫🇷 France | com |
| 11 | parlons-basket.com | 72,234 | $1.78K+ | 🇫🇷 France | com |
| 12 | actividadesdeinfantilyprimaria.com | 82,069 | $2.35K+ | 🇫🇷 France | com |
| 13 | tipsenweetjes.nl | 84,535 | $1.35K+ | 🇳🇱 Netherlands | nl |
| 14 | laopinion.co | 88,871 | $2.22K+ | 🇺🇸 United States | co |
| 15 |
|
97,215 | $1.38K+ | 🇪🇸 Spain | es |
| 16 | lopezdoriga.com | 118,487 | $797+ | 🇺🇸 United States | com |
| 17 | atalayar.com | 125,870 | $1.95K+ | 🇪🇸 Spain | com |
| 18 | objectifgard.com | 134,751 | $1.83K+ | 🇫🇷 France | com |
| 19 | dicionarioinformal.com.br | 135,857 | $1.92K+ | 🇧🇷 Brazil | br |
| 20 | pourquoidocteur.fr | 137,829 | $11.35K+ | 🇫🇷 France | fr |
This is 20 of 564 websites. Download up to 1M sites per list as CSV, enriched with firmographics.
| Company | Website | Employees | Industry | Country | Founded |
|---|---|---|---|---|---|
| Le 11 Amiénois |
|
1-10 | Online Media | 🇫🇷 France | 2017 |
| Récord Mx |
|
51-200 | sports | 🇲🇽 Mexico | 2002 |
| Carbajosa Noticias |
|
- | - | 🇪🇸 Spain | - |
| La Voz De Michoacán |
|
201-500 | Newspaper Publishing | 🇲🇽 Mexico | - |
| DESIblitz® |
|
11-50 | Advertising Services | 🇬🇧 United Kingdom | 2008 |
| NRT México |
|
201-500 | Media and Telecommunications | 🇲🇽 Mexico | 1994 |
| Portal POP Mais |
|
- | - | 🇺🇳 - | - |
| Agazeta.net |
|
1-10 | Individual and Family Services | 🇺🇳 - | - |
| Bbmundo |
|
11-50 | - | 🇲🇽 Mexico | - |
| El Progreso |
|
51-200 | Information Services | 🇪🇸 Spain | - |
| NOVABRASIL |
|
51-200 | Broadcast Media Production and Distribution | 🇧🇷 Brazil | 2000 |
| Osasuna1920.com |
|
1-10 | Information Services | 🇪🇸 Spain | 2012 |
| Touchdown Actu |
|
11-50 | Online Audio and Video Media | 🇫🇷 France | 2007 |
| Hotels Met Laadpaal |
|
1-10 | Hospitality | 🇺🇳 - | - |
| Dietitian Fit & Co |
|
11-50 | Wellness and Fitness Services | 🇬🇧 United Kingdom | 2018 |
| Algarabía Group |
|
51-200 | Entertainment | 🇲🇽 Mexico | - |
| Tuboleta Colombia (oficial) |
|
51-200 | Entertainment | 🇨🇴 Colombia | 2000 |
| Autointer Sa |
|
11-50 | Retail | 🇪🇸 Spain | - |
| Estação Nerd |
|
1-10 | Technology, Information and Internet | 🇧🇷 Brazil | 2015 |
| Estrelando |
|
1-10 | Retail | 🇧🇷 Brazil | - |
| Gpfans |
|
51-200 | sports | 🇳🇱 Netherlands | 2017 |
| Associated Medias |
|
11-50 | Book and Periodical Publishing | 🇺🇳 - | - |
| Techguru |
|
1-10 | Media Production | 🇦🇺 Australia | 2024 |
| El País |
|
51-200 | Newspaper Publishing | 🇨🇴 Colombia | 1950 |
| InfoNegocios |
|
11-50 | Broadcast Media Production and Distribution | 🇦🇷 Argentina | 2003 |
| Revista Vistazo |
|
51-200 | Online Media | 🇪🇨 Ecuador | 1957 |
| Revista Flow |
|
1-10 | Book and Periodical Publishing | 🇲🇽 Mexico | 2015 |
| Record TV Americas |
|
11-50 | Broadcast Media Production and Distribution | 🇺🇸 United States | - |
| Jara Y Sedal |
|
1-10 | Online Audio and Video Media | 🇺🇳 - | - |
| Editorial Aguasclaras S.A. |
|
51-200 | Newspaper Publishing | 🇨🇴 Colombia | - |
| Golf Post |
|
11-50 | sports | 🇩🇪 Germany | 2012 |
| The Northern Premier League |
|
1-10 | Spectator Sports | 🇬🇧 United Kingdom | 1968 |
| Moda 20. |
|
11-50 | - | 🇧🇷 Brazil | - |
| FirstSportz |
|
51-200 | Spectator Sports | 🇺🇸 United States | 2019 |
| Palmeiras Online |
|
1-10 | Online Media | 🇧🇷 Brazil | 1996 |
| La Guía De Franquicias |
|
11-50 | Business Content | 🇲🇽 Mexico | 1991 |
| Tv Guararapes |
|
51-200 | broadcast media | 🇧🇷 Brazil | - |
| Www.mangaforever.net |
|
51-200 | Online Audio and Video Media | 🇺🇳 - | 2006 |
| Revista PLÁCET Madrid |
|
1-10 | Online Audio and Video Media | 🇪🇸 Spain | 1989 |
| El Contribuyente |
|
11-50 | Broadcast Media Production and Distribution | 🇲🇽 Mexico | 2014 |
A sample of enriched company profiles. Full exports include company, social, and spend signals on every domain.
Put it to work
All 564 of these sites already run Seedtag, with the online audio and video media segment leading at 16 sites. Pitch the products and services that fit that exact stack.
Selling Meta Business Suite, Google AdSense, or another Advertising Software product? These 564 Seedtag users are your displacement audience, filterable by country and company size.
Top markets for Seedtag: France (21.5%), United States (17.1%), Italy (16.5%). Size the Advertising Software market by geography before you build or invest.
Free for non-profits, academia & data journalists - non-commercial and public-interest use, on request.
Request accessUnlock Seedtag and download unlimited filtered reports for a month: up to 1M sites per list, segmented by country and TLD.
No contracts, cancel anytime · Instant access after checkout · Data point availability varies by website and report